SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000028m|PACid:20208357 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000028m|PACid:20208357
Domain Number 1 Region: 612-716
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-22
Family B3 DNA binding domain 0.016
Further Details:      
 
Domain Number 2 Region: 455-557
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.04e-20
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 3 Region: 136-237
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-19
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 4 Region: 937-1034
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-17
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 5 Region: 297-393
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1e-16
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 6 Region: 834-913
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000149
Family B3 DNA binding domain 0.0067
Further Details:      
 
Domain Number 7 Region: 1-81
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000294
Family B3 DNA binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000028m|PACid:20208357
Sequence length 1036
Sequence
MIPVDFFSMYVEGKRSVEKTTAELKSDSSDITWRAKMTGRRLSDGWEEFAVANNFRTGDV
VLVRYEGDLVFHVSDLGPNCCDVTFPSNKDQNNNNCDFLLKKHKHPRTDVGDDEEVPKKK
KVKKKNSVDETEADSSSLDNSCFVANVTASNLCTDTLYLPQHFTSSNGITIKCRKIVLID
GGERSWALDLMLDETSDTFYISRGWRRFCEENGKKAGGFFTFKLVGNGETPVLSFSPTES
IDNRRPRDCSEATGRVSLSTELSNKEADIEGERNEDECRILETEKKKRRVLSYASYSPCR
KRFVTFTLPPDYDRIRRLTLPKPFVMENGINKGGEIYLLGKDGRKWPTSLLLDKTGQMRW
RKGWKEFVKGNGLESGFTLKLIWEGTTPVFSLCSAESASDREEKEFSKAVEKQSIFKDPS
KKDKIGKDENKKEERRSMERGKDHLRGRNSTASSQDQFLSFTITPYSVEKCILPLPRKFT
RENGINKPRMITLLGKDGIKQQTKLLFSKGKKAALGNGWKSFVKANGLKIGDSFTLKLIW
EETTPMLSLCHGECSIDRGESSETDQKNSLPIEPSSCEKLSKDENSKVENKETMSMEREK
NHLRGRESTPSSQKQSVTLTMTPYSVKKCILRLPKAFTRENDINKHAMIILLGKDGIKHQ
TKLLWDKGTGIMTLGKGWMDFAKANGLKTGNSFTLKLTWEDTTPVLSLCHAECSMDRGSG
GECSETDQKKSLPIEPSSCEKISKDENSKEKNNNEANKKEETMSMEREKNHLRGRDSTPS
TQKQLMTLTITPSSYSKCKLVSLSNNSCFRIQMISFFSCTLIGIIRILLSNLFQTLPAQF
ARENSLNKPGMIDLLGKDGKKWMVNLVQDGDGRMNLGNDWKEFAKANDLKTGESFKMELI
SEDGTRMLKLVHSNPNSSKANEKESTEPRSRDSSSAIQNRTLTLTLTPEDVRACILHLPS
QFMKANGINKLGEITILGENKVEWSAYLLSIRDGTVALENGWDEFCKANGVKLGESFTLE
FVYELNTSIVLKFCSR
Download sequence
Identical sequences V4NJI6
Thhalv10000028m|PACid:20208357 XP_006405008.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]