SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000097m|PACid:20208741 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000097m|PACid:20208741
Domain Number 1 Region: 174-275
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-18
Family B3 DNA binding domain 0.007
Further Details:      
 
Domain Number 2 Region: 342-446
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.84e-18
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 9-107
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000167
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 4 Region: 495-600
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000961
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000097m|PACid:20208741
Sequence length 607
Sequence
MAKPTLLLHPQFFHTLVPGFNTHLTIPLEFFSKYIEGKTSVEKTTAELKSDSSDITWKVK
MTGRRLSDGWEEFAVANNFRTGDVVVVRYEGDMVFHVSDLGSSCCEIQDIPPLSNNSYGQ
DDIGKNLLKKRLHPRTQVVFSSNDVDDEDNLEIPVKKKAKKNSPEAEEVSSSSSDDSCFV
AMVTPSSLRTDKLYLPQYVTNSSGITRKCRKIVLTDGEERSWALDLRFSKSSDSFYISRG
WRKFCEENGREAESFFMFKLVRNGETPVLGFCPSESCNDKRQRNCSEASGRESFSTEISS
GEENIEGESSEDDCSSMESLMETKEKKCSLKRRILSCSSYSPRYKRFVTFTLPPDYDRIR
RLCLPRSFLRENGINKTGEIYLLGKDGKKWLTNLQRDKNGTMKMEMGLKDFVKANGLKMS
ESFTLELIWEDTTPMLSLCPAECSIDRGAGGECSETDQENSLSIEPSSYEKISKDENKSV
STKPRSRDSSSAIQNRFAELTLTPEDVRACKLVSSSSNLHLPRQFMKANGIGKLGKITML
GKEGTKCSAFLLSRDGFVALGIDWKWFCEANGVRTGESFTLEFISEQTKTTYVLKFCSRE
TNKYKIC
Download sequence
Identical sequences V4L7W8
XP_006405007.1.70970 Thhalv10000097m|PACid:20208741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]