SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000111m|PACid:20208496 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000111m|PACid:20208496
Domain Number 1 Region: 288-388
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-24
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 443-541
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-19
Family B3 DNA binding domain 0.0071
Further Details:      
 
Domain Number 3 Region: 3-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-19
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 4 Region: 135-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-18
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000111m|PACid:20208496
Sequence length 549
Sequence
MANKHFFKPLLPGFHSHLTIPVAFFLKYIKGTNEQKKTTAKLRSDASDITWEVKIEDGQK
LTDGWKEFVLAHDLRVGDIAIFRQEKDMAFHVTLMGPSCCEIQYESGLDDENNLGKIPKK
TKVKKNPRKETESSSLDPSCFVAHVTHASLRYDSLNLPMSFARANGLNTRCGEIVLMNDK
GRSWTLALKQKKCGSTYIRRGWRTFCSANGFKAGEAFTFKLIQRGKVPVLRLSTTESEEE
EESSGADEVESLSTEPESDEESNLAEIQRRKKLKKNPERETESYPLDPSYFVAKVSPSTL
RQDRLYLPRNFSRENGLDTRCGEIVLMNEMGRSWTLNLKRKNSCGTAYIRRGWRSFCRAN
GLRAGDSITFKLIQRGGTLVLRLSPTDSEEEEEEEEEEEEEESSEGDEIESLSTEQESDE
EGNQDEKSFKKPRLLWKASSTPSQNRFVTLTLKPFNLTKYVMLLPIPFTRMHGINEETKM
SLVDKHGVRWSTNLRSEITGDRIRMVGGWQEFFKANCVKIGESVMLKLIWEGDKSCVLKF
CSKLKQVTK
Download sequence
Identical sequences V4LRK3
XP_006405006.1.70970 Thhalv10000111m|PACid:20208496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]