SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000541m|PACid:20208467 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000541m|PACid:20208467
Domain Number 1 Region: 14-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000824
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000541m|PACid:20208467
Sequence length 131
Sequence
KMNYYSEFRIDPAMIISKKLSKRDLDGNVKLPKIQVMSVFKKMKGVTHETLQNGIEVKVL
DTAEADPNTNYKSDEYTVTLRCIDNNKFYFGVGWSTMKHSMDLKEGETLELYWDYLHETF
IVLNIPYLVMD
Download sequence
Identical sequences V4NJ54
Thhalv10000541m|PACid:20208467 XP_006404863.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]