SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000579m|PACid:20208620 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000579m|PACid:20208620
Domain Number 1 Region: 21-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-22
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 295-375
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000844
Family B3 DNA binding domain 0.0086
Further Details:      
 
Domain Number 3 Region: 197-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000314
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000579m|PACid:20208620
Sequence length 378
Sequence
LPRKKKVKMNSSETEADSPSSDHSCFVALVTASNLQDDALYLPKEFTSSNGLTRRCRKIV
LTDGGERSWTLDLRFNKSSDTFYITRGWRIFCDENGKKAGSFFMFKLMKNGETPLLSFCP
AESRGEKASNKESLTIQPSSGKQISKEERKKNHLRCRDSTSPIENRYVTLTATHDSLKKG
RLFDHLHSYWLYSPFESFLNLPLQFIRDNGLDKPGMVTLLGKDGTRWLANLRRETTGTMN
LGKGWKDFAKANNNKERVVQKLARKSLFLQNLSVETRPGQEHYSGEKCKGAVAKQHLPSQ
FMRDNGIDKLGKITLLGKEGMTCSAYLLSKDGFVALGIDWKGFCEANGVKIGESFTLEFI
SEQYKTTYVLKFCSNCGD
Download sequence
Identical sequences V4M2J6
XP_006405010.1.70970 Thhalv10000579m|PACid:20208620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]