SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000999m|PACid:20202791 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000999m|PACid:20202791
Domain Number 1 Region: 11-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-23
Family B3 DNA binding domain 0.00019
Further Details:      
 
Domain Number 2 Region: 165-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000255
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000999m|PACid:20202791
Sequence length 263
Sequence
MAETDNDVVLPRFFKVFLSETASESMSIPVSFSEHLEDPLPQTVKLQGTGGGIWTVSFKK
IRQRAYFTAGWSKFAEDHDLKNGEFLTFVYDGYNTFEVSVYNRWGSKETRAVKETVEISD
TESEEEEEAVADSDYEEEEEDPLVDGGEDTESDDAGISQSEVTSMSMTNPYFTTGLKNRI
YELLIPAEVVKDMGFRFGESIKYVDEEGTMVGERGKWADDRICFKGWDRICRRNRLRVQD
KVNCEMLHHRKLVHSIKIHITRG
Download sequence
Identical sequences V4KNU7
Thhalv10000999m|PACid:20202791 XP_006398097.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]