SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10001555m|PACid:20188796 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10001555m|PACid:20188796
Domain Number 1 Region: 30-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-30
Family B3 DNA binding domain 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10001555m|PACid:20188796
Sequence length 317
Sequence
MMTNLSLTRELGEEDEEAEAKRPVEEVEREHMFDKVVTPSDVGKLNRLVIPKQHAERYFP
LDSSSNEKGLLLNFEDLTGKSWRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDIVSFQR
CIGDSGRDSRLFIDWRRRAKVPDHPTSIAHFAAGAMFPSFYSFPTTTTSTSYNLYNHHHQ
PRHLQSSGYSYPQIPREFGYGYFVRSVDQRAVADPLVIESVPVMMHGGARVTQAVVGAAG
KRLRLFGVDMECGESGVTNITEEDSSSSGGSLPRGGGGGGGASSSSSLFQLRLGSSSEDD
HFSKKGKSSLSFDLDQY
Download sequence
Identical sequences V4N2C3
Thhalv10001555m|PACid:20188796 XP_006397878.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]