SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10001785m|PACid:20189016 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10001785m|PACid:20189016
Domain Number 1 Region: 186-280
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-22
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 14-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000049
Family B3 DNA binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10001785m|PACid:20189016
Sequence length 284
Sequence
MGRNRAFGKIQEDRKKTSFFKILADEDLSSEAMRFNPQKFWRGSVCKNIPHKVILKVVWG
RSWKVKLSKFMGSYLMEKNGWEKFLYDNKLGDREFLTFTNEGNNCLTVNIFEKNCKEILQ
PQRTTTTVIASSSSKDVKKEEMSCVIAESTGRGAKRKNKRAEEEEERKKSKKMKKKAGNN
VYGASSSSSAATFSLTIKQSHLLVLIIPNDFAKMHMPKKTAKLIIHDPKGKSWKVVYFCS
NKTKIFSSGWRILARDYGLAVGDVCTFRLIKPKEMVLQVSHASP
Download sequence
Identical sequences V4L5Z1
XP_006397596.1.70970 Thhalv10001785m|PACid:20189016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]