SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10004496m|PACid:20199788 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10004496m|PACid:20199788
Domain Number 1 Region: 14-116
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-21
Family B3 DNA binding domain 0.00036
Further Details:      
 
Domain Number 2 Region: 232-322
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000124
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10004496m|PACid:20199788
Sequence length 351
Sequence
MVESGEKVSPPSSSQPKDLEFFKVFLPEFSARELEIPTAFIDILEKPIPKQVLLVDEIGR
LWGVETKAEERNRLVVFQKGWERFANDQSLEFGDFLVFSYDGDSRFSVSIFAKEGCKKDL
GVVSTNRVSVEKGPVAVEPADISTNPGRRERRGKRVNLNRKRDLVKEKPSVRAETEPQYV
STIKTEPDYVPAIKTEPKHRENTLRKVNRSRDPCGISWVPKKKHKGFEESEYKPKNPHFV
RNITSGSLRQMEIPTTFLKSNGIDMEKDIELCDENGKKWPLKIVNHCSRGLKFSYDSWLL
FSQSHKLRRPDKCLFEFIVTSDGRCNQVLVRILPGRLLTTVSKNRYQVLAM
Download sequence
Identical sequences V4KUZ7
XP_006393897.1.70970 Thhalv10004496m|PACid:20199788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]