SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10006123m|PACid:20190422 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10006123m|PACid:20190422
Domain Number 1 Region: 18-129
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-32
Family B3 DNA binding domain 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10006123m|PACid:20190422
Sequence length 300
Sequence
MNPEEEKPVEEASSMEREHMFDKVVTPSDVGKLNRLVIPKQHAERYFPLDNSSTNDNNKG
LLLNFEDRTGNSWRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDIVSFQRDPGNKDKLY
IDWRRRPKIPDHHHQFAGAMFPRIYSFPHPQMPTNYESHNLYHRFQRDLGIGYYVRSMER
SHPTAVIESVPVMMQRRSQVAAMASSRGEKRLRLFGVDMECGGGGGGGASVNSTEEESSS
SGGSMPCGSVSMAGAGSLLQLRLVTSDDESLVAMEAASVDEDHNLFTKKGKSSLSFDLDR
Download sequence
Identical sequences V4LN25
XP_006402424.1.70970 Thhalv10006123m|PACid:20190422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]