SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10006535m|PACid:20185720 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10006535m|PACid:20185720
Domain Number 1 Region: 818-1042,1163-1210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-71
Family Tandem AAA-ATPase domain 0.000000268
Further Details:      
 
Domain Number 2 Region: 521-808
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.93e-46
Family WD40-repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 1214-1320,1416-1499
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.54e-41
Family Tandem AAA-ATPase domain 0.0000428
Further Details:      
 
Domain Number 4 Region: 1521-1653,1719-1801
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 6.28e-40
Family Helical scaffold and wing domains of SecA 0.0012
Further Details:      
 
Domain Number 5 Region: 1041-1162
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 1.44e-36
Family Pre-protein crosslinking domain of SecA 0.0000608
Further Details:      
 
Domain Number 6 Region: 4-65
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000144
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 7 Region: 175-282,310-443
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000295
Family Protein kinases, catalytic subunit 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10006535m|PACid:20185720
Sequence length 1804
Sequence
MEPPECPVCLQSYDGECTVPRVLSCGHTACEECLKNLPKKFPNTIRCPACTVLVKFPPQG
PSALPKNIDLLRLFPSVSRITLEPGKNLKKPIEFVTRSWSDDFYTTWKDRILLHDAVSVE
NVESEGSDFGSSRRLCGWLKDDSRVSLLRVASFLNDDCDSLLKYSYVQRMMSCLWEMREE
ERDELDTIISVKQRGISKVFGLWGDLKNGVLYLVGEKLTGYSCEEFDYLDEDETSCFAVI
GMQICEALLNLHKEGVITGCLSVSCVKFDEFGNAYVDLIELLEIGRIVYGIISDESSSCS
KPVGALEMGMILNRLVKEGIFMSSEVLFELLKEQNMLKLNASSKYLVSYSSDVWPVCFLL
LKLLLGKRFSEELIENVNGVDAKECEEQIEDLLVLYTGFTEKLSSILESKLGGKFKSIIE
IIRQSCCLDSQARPVLTDLWKCYRELVMNRRLIYMIGLHKTKSQKRKEFCVVLGELCHLV
VVGSRELEEEVPGMENSGGAEEGKFDIDFVERLSEGKIKSKDLRGHQDSVTSLAVGGGFL
FSSSIDKNIHIWSLKEFSHVHTFKGHQERVMALIYIEGAESVCVSGDSGGGIFVWSTSFP
LEEQPLRKWYEPKDWRYTGIHALAYSEDGYVYSGSGDNTIKAWSLQDGSLVCTMTGHKSV
VSTLVVLNGVLYSGSWDGTVRLWSLSDHSFLTVLGEETQGIVRSILSLAVDGQTLVAAYQ
NGDIQIWRDDTLMKSMKIQSGAILSIAVNGKWLFTGGWDKTVSVEEFSGDEISLDCTHVG
SIPGSSVITSLLYWEGKLFAGFADKTIKGNLGRLKRNLQDVTSMNYWVVRDYYRLVESVN
SLEPHIQSLSDEQLKAKTAEFRERLARGESLADMQAEAFAVVREAAKRTIGMRHFDVQII
GGGVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVNDYLAQRDAEWMGRVHRF
LGLSVGLIQRGMKAEERKFNYSCDITYTNNSELGFDYLRDNLTSNSEQLVMRWPKPFHFA
IVDEVDSVLIDEGRNPLLISGEANENAARYPVAAKVAELLVKDIHYKVELKENSVELTEE
GISLAEMALDTGDLWDENDPWARFVMNALKAKEFYKRDVQYIVRNGKALIINELTGRVEE
KRRWSEGVHQAVEAKEGLEIQADSIVVAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMF
QIPVIEVPTNLSNIRIDLPIQAFATARGKWEYVRREVEDMFGQGRPVLVGTTSVENSEYL
SALLKEWGIPHNVLNARPKYAAREADFIAQAGRKYAITISTNMAGRGTDIILGGNPKMLA
REIIEDSILSYLTSEVLADDVDDSELSQKVLSKIKVGPSSLALLARASLMAKYVGKSESK
SWTRKKAKSVVTESLEKSQTMDPMELQNLVNEQSEMYPLGPAIALAYLSVLQDCEAHCLH
EGSEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMVSLQDEMFQKFNFDTE
WAVRLISKITNDEDLPIEGDTIVKQLLALQINAEKYFFGIRKSLVEFDEVLEVQRKHVYD
LRQLLLTGDNESCSQHIFQYMQAVVDEIVVGNSDPQKHPRYWSLAKLLKEFMAISGNLLD
ESFSGITEGTMLQSLENLHETSSIDMEDFYLPHLPKPPNAFRGIRRKNSSLRRWLDICSD
DLTGSGRYRTSINLLRKFLGDYLIASYLNVVQESGFDDGYVKEIERAVLLKTLDCFWRDH
LVNMNKLSSAVNVRSFAHRNPLEEYKIDGCRFFISMLSATRRLTIESILQYWSSPMESQE
LFVS
Download sequence
Identical sequences V4KTM1
XP_006416281.1.70970 Thhalv10006535m|PACid:20185720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]