SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10006635m|PACid:20185449 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10006635m|PACid:20185449
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.4e-44
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 969-1033
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000177
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10006635m|PACid:20185449
Sequence length 1083
Sequence
MKAPSNGFHPNSTEGEKKAINSQLWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKQ
TDFIPNYPNLPSKLICLLHSVTLHADTETDEVYAQMTLQPVNKYDREALLASDMGLKLNR
QPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLHDTTWTFRH
IYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFVRDEKSQLMLGIRRANRQTPTLSSSVIS
SDSMHIGILAAAAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMF
ETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQVGWDESTAGDRPSRVSIWEIEPVITP
FYICPPPFFRPKYPRQPGMPDDDLDIENAFKRAMPWMGEEFGMKDAQSSMFPGLSLVQWM
SMQQNNPLSATTQLPSALSSYNLPNNFASNDPSKLLNFQSPNLSPANSQFNKPNMVNHIS
QQMQAQPAIVKSQQQQQQQQQQLQQQVQMSHQQLQQHHQQQQGIYNIGSVNNGVTVVSNQ
ASCQNQSTGFSQAQLQQQSMLSNGATMTQQNIVSGGIKGSSQMTSLAQELQFQQQLELHN
SSQLLRNQQEQSSMHTLQQTLSQNPQQLQMQQQSSKQSPSQQLQLQLLQKLQQQQQQQSI
PPVSSSIQPQLSALQQAQSHQLQQLLSSQNQQPLAHGNNSFSASTFMQPPQIQVSHQQQG
QMNNKPLVTTGRSHSGHTDGEAPSCSTSPSANNTGHDNVSPTNFLSRNLQQGQGVSVSPS
DSVFERASNQGQELYAKTESRVNQGMVNLKSAPEHFKFKGAVTDQLDVSTAGATYCPDVV
GPAQQQQTFPLPSFGFDGDCQSQHPRNSLGFAGNLEAVTSDALYSQKDFHNLVPNYGNAP
RDIETELSSAAISSQSFGIPSIPFKSGGSNEIGGINDSGIMNGGGLWPNQTQRMRTYTKV
QKRGSVGRSIDVTRYSGYEELRHDLARMFGIEGQLEDPQTSDWKLVYTDHENDILLVGDD
PWEEFVNCVQNIKILSSAEVQQMSLDGDLAAIPATNQACSETDSGNAWKVHYEDTSAAAS
FNR
Download sequence
Identical sequences V4KB06
XP_006416527.1.70970 Thhalv10006635m|PACid:20185449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]