SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10007829m|PACid:20187446 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Thhalv10007829m|PACid:20187446
Domain Number - Region: 356-388
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00251
Family Rho termination factor, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10007829m|PACid:20187446
Sequence length 395
Sequence
MSGTFHLTSDYVPGYTLSDRRCFSNSTVLRTTLAILPCSSSLDQTLRVENGRLKCGPNSS
SFVCRASSGGYRRNPDFSRLNKHGFRGRNRQSEEKDDFDAENSDMLSSSNGPLLSLSNSP
KFQATSSPGPREKEIVELFRKVQAQLRARAMAKREDKKIEEASKGQGKESETVDSLLKLL
RKHSGEQSKKVNSFSSQGDNSYQRQGDPMDRQDRSGNIVNSRNKDHNASSFIRPTSSFRR
KSPVPRSKSPPTYSSEATFDQASSYSVTWTHKKDTVESHDEPAEPEYEDEPEYESEPGHV
TAILEPELELKPEPSSFYQDEDDDVTLDALSDDDESLDDTDEEAVDEAEEEVVKEKDLSI
LKLMELRGIAKSRGLKGFSKMKKAELVELLGRNSS
Download sequence
Identical sequences V4MVQ7
XP_006417948.1.70970 Thhalv10007829m|PACid:20187446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]