SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10007983m|PACid:20187835 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10007983m|PACid:20187835
Domain Number 1 Region: 194-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-31
Family B3 DNA binding domain 0.00000848
Further Details:      
 
Domain Number 2 Region: 66-122
Classification Level Classification E-value
Superfamily DNA-binding domain 5.04e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10007983m|PACid:20187835
Sequence length 367
Sequence
MEYSCIDDTTSTTSESLSTSTPSPKKTTEKLSPPAMRLYRMGSGGSSVVLDSDNGVETES
RKLPSSKFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAASSYDIAARRFRGRDAVTN
FKTPAIDNDGDDAESAFLESHSKAEIVDMLRKHTYADELQQSKRRFLDGNGNGKRCESTT
IMTSPHGNDGVLRPREVLFEKTVTPSDVGKLNRLVIPKQHAEKHFPLPAMTTATATTNPS
PTKGVLINLEDRAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDAVCFERSTGPD
RQLYIDWKVRSGTELISTPVQTVVRLFGVNIFKPNDVAGECGGKKRSREVDLFALGCSKK
QAIINAL
Download sequence
Identical sequences V4KSG6
XP_006415886.1.70970 Thhalv10007983m|PACid:20187835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]