SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10009706m|PACid:20185609 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10009706m|PACid:20185609
Domain Number 1 Region: 16-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000153
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10009706m|PACid:20185609
Sequence length 125
Sequence
MMNHMKGPKGYETEGPRLIFEKKLTKTNIRPDQSRLLMPFKSLIRNDFLRPGIGAILVDQ
RNVKVGLMLTRWDMKKNSGGGTLNYALTCGSNDIVKGNRLKKDDDISFWSFRCHNVICFA
LVLPP
Download sequence
Identical sequences V4MP58
Thhalv10009706m|PACid:20185609 XP_006415073.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]