SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10009730m|PACid:20186320 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10009730m|PACid:20186320
Domain Number 1 Region: 216-322
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000167
Family B3 DNA binding domain 0.015
Further Details:      
 
Weak hits

Sequence:  Thhalv10009730m|PACid:20186320
Domain Number - Region: 127-182
Classification Level Classification E-value
Superfamily ARM repeat 0.00575
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10009730m|PACid:20186320
Sequence length 330
Sequence
MAKYYDDHLAAAEKDISSRNFCNLKAKSKFNTRIFSEEEEESDKRFFHVFSRKRRGSVVT
RRNTEQQSHQNLIVASTSSSYHHATVEGDIISSRDICNMVDAIAQARLYEEIKLKGKSKH
NTKTLSDEEEEDEDEDEDDEEKEDDDHEDDEEDEDEEKEKEKEDEEEDEEKEEETNRRNF
LQETRRESVVVIATPECLTEMMNHMKGPKGYETEGPRLIFEKKLTKTNIRPDQSRLLMPF
KSLIRNDFLRPGIGAILVDQRNVKVGLMLTRWDMKKNSGGGTLNYALTCGSNDIVKGNRL
KKDDDISFWSFRCHNVICFALVLPPHPKIN
Download sequence
Identical sequences V4K739
XP_006415072.1.70970 Thhalv10009730m|PACid:20186320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]