SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10009849m|PACid:20185584 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10009849m|PACid:20185584
Domain Number 1 Region: 172-276
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-21
Family B3 DNA binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10009849m|PACid:20185584
Sequence length 365
Sequence
MDNFLPFSSPNANSVQELSMDLNTNRSHFSTVPTYDHHQAHHHYHMLPPYPNIACPVDPT
AVMNPQPLHSSEAFSRFPFTRTGSEFGSLVCNPGLRQERGGFLDPHMTKMARINRKKAMI
RSRNNYCPNSSSNELVDSRRQVALNMKNNSETTAKKDLFRFSSFDNKKLRVLLVKHLKNS
DVGSLGRIVLPKREAEGNLPELSDKEGIMVEMRDVDSVQSWSFKYKFWSNNKSRMYVLEN
TGEFVKKNGVETGDSLTIYEDESKNLYFSIRKYSGKQNEGREDESMEVNDMNFLEDLTFD
YIPNDEEEDSIAMLIGNLNDHYSIPNDLMDLTTDLDQATSSSPHLDHLSDGHATSDHVSS
NDFVW
Download sequence
Identical sequences V4L2S2
XP_006415675.1.70970 Thhalv10009849m|PACid:20185584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]