SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10010831m|PACid:20206778 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10010831m|PACid:20206778
Domain Number 1 Region: 24-117
Classification Level Classification E-value
Superfamily TSP9-like 1.24e-16
Family TSP9-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10010831m|PACid:20206778
Sequence length 117
Sequence
MVSSLLMSFAPATVRVYATTAKGASGGAKEEKNPLDFVLGYLTKQDQFYETDPILKKVEE
KEGSRSGGTKSGGTKSGGTNGGRGTVRGGGKNSTPVPVPPKKSDGGFGGLGGFFNKK
Download sequence
Identical sequences V4L6A3
Thhalv10010831m|PACid:20206778 XP_006404417.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]