SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012343m|PACid:20184712 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Thhalv10012343m|PACid:20184712
Domain Number - Region: 182-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00133
Family B3 DNA binding domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012343m|PACid:20184712
Sequence length 288
Sequence
MKKDDYYQEPSSQPNKYWKLDILADVAAREYSSMINLEILVKVASAMLEEYETSKNTLVS
PCASLPRKKTSQLSHRPASTQWVKNKSIACVDYKQEEEDKSFKKRKIVGRCKVGSSSTST
KEQKVLENLDWDPESLPSSCITECSKKKCPPTNISCKKLKIVHRGPTQTTNGQPNPPEWL
LNLIITKHLFQSDLDKGKNRLQMPINQLVNTNFLTEEETRIIYEKLVLTRETGLIVVLVD
PLSKGHVVDFRKWKMGKNWFKVGDVYSVWSFRSGQGNLCFALVPDKFR
Download sequence
Identical sequences V4KKE0
XP_006393106.1.70970 Thhalv10012343m|PACid:20184712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]