SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012491m|PACid:20203907 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10012491m|PACid:20203907
Domain Number 1 Region: 459-627
Classification Level Classification E-value
Superfamily BRCA2 helical domain 5.1e-55
Family BRCA2 helical domain 0.00048
Further Details:      
 
Domain Number 2 Region: 628-756
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-37
Family Single strand DNA-binding domain, SSB 0.00016
Further Details:      
 
Domain Number 3 Region: 758-787,906-991
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.48e-25
Family Single strand DNA-binding domain, SSB 0.011
Further Details:      
 
Domain Number 4 Region: 788-906
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.41e-18
Family BRCA2 tower domain 0.0023
Further Details:      
 
Domain Number 5 Region: 994-1149
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000308
Family Myf domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012491m|PACid:20203907
Sequence length 1163
Sequence
MSTWQLISDSSGDCFRWEVAGRILQSDSDSSPTKTLLESTPPLPSMADLLRQGCSKLVER
EEPMPGEILMFRTGLGRSVALKESSIARAKSILADDNVVYSDLQDTGCSNLQKRQVDTAG
NLPMFTTALGKSVPLKDSSIAKAMSILGGDLIDSGNVLPRESGFGDPTSLFQTASNKKVI
LSSPGLARAKALLGRGEDDLNGFNHVNRSFSSHQQHGWSELKTHEEFDATAVQRHSGTPG
QYEGHVFGKMSEVLNPSSKVPPTKFQTAGGKSLSVSVEALKRARNLLGDPELGNFFDDVA
VGDQFVTPQKDKRLGDIPINNGSANTGSITHEGKTSHKHTSNSFISPLRSSSKKFRSVKS
KDLASGANSIKKFDAALDKTDCSLNSTKLATHGISNGRPSASDIAVTSSKEISFIPRGKQ
FGRPSDQPLVDITNRSDTAYANNKQGSTQKKRLGNTVSVSPFKRPRNSSFKTPLKKNAQH
ASSGLSVVSCDTLYSKKVLSTRYPEKSPRVYIKDYFGMHPTATPKMDYVPDHVRRIKSSN
ADKYVFGDGSSSNVVGAETFLQMLAECGASLQQVSRKWVTNHYRWIVWKLACYETYYPAK
CRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAPASSMMVLAVSAINPKTDNDS
QETHGSDSGSNMKVELTDGWYSMKAALDVMLTKQLNAGKLFVGQKLRILGAGLSGWANPT
SPLEAVVSNTICLLLNINGTYRAHWADRLGFCKEVGVPLAFNCIKCNGGPVPKTLAGITR
IYPILYKERVGERKSIIRSERMESRMIQRHNQRRSALIEGLMCEYQREINGFHSQNDTDS
EEGAKVFKLLETAPEPELLMAEMSLEQLTSFATYKAKYEAAKQLQMEKSVAKALEDAGLG
ERDVTPFLRVRLVGLTSLTYEGEHNIKEGIVTIWNPTERQRTELREGKIYMMKGLVPMNS
DSEILYLHARGSSSRWQPLSPKASESFQPFFNPRKLIYLSNFGEIPLSSEFDIAAYVVYV
GDAYADFQQKKQWVFVTDGSTQHSNSHSGETTSNSLLAISFSTPSMDDFPTPYISHNLVG
SVVGFCNLLKRAKDAKNDMWVGEATENSIYFINVEAAYSSHLKTSSAHIQTWAKRPSSNS
VIRELRQRVLFIIGACQSPSSSR
Download sequence
Identical sequences V4LCG1
XP_006398599.1.70970 Thhalv10012491m|PACid:20203907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]