SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012728m|PACid:20205149 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10012728m|PACid:20205149
Domain Number 1 Region: 168-280
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-42
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 666-743
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000054
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012728m|PACid:20205149
Sequence length 791
Sequence
MEFDLNTEIAEVEDEEKDDGGVVGTGIEKGRLGISPSSSSSCSSGSSSSSSTTVSASSIY
SELWHACAGPLTSLPKKGNVVVYFPQGHLEQDPLVSYSSPLEIPKFDLHPQIFCRVVNVQ
LLANKETDEVYTQVTLLPLQEFSMLNVEGKEVRELGGEEERNGSSSVKRTPHMFCKTLTA
SDTSTHGGFSVPRRAAEDCFAPLDYKQQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLT
TGWSIFVSQKNLVSGDAVLFLRDEDGELRLGIRRSARPRNGLPDSIIEKNSCSDILSLVA
NAVSTKSMFHVFYSPRATHAEFVIPYEKYTTSIRNPICIGTRFRMRFEMEDSPERRCAGV
VTGVCDLDPYRWPNSKWRCLLVRWDESFVSDHQERVSPWEIDPSGSLPHLSIQSSPRLKR
PWAGLLDTTPPGNPITERGGFLDFEESVRPSKVLQGQENIGSASPLQGFDVMNRRILDFA
MQSHANPVLLSSRVKDRFGEFVDATSLDPACSGVMDLDRFPRVLQGQEICSLRSFPQIAG
FSPAATSGKPSLGYTDPFAYNQANKSSFYPLASQGIRSSHIPYQNPYNAGEKSSVHPINF
GGESRKLDAQNEGGLPKNVTADLPFKIDMMGKQKGGDFDMNASSECKLFGFSLPVETPAA
NPQSSSKRICTKVHKQGSLVGRAIDLSRLNGYNDLLTELERLFNMEGLLRDPEKGWRILY
TDSENDMMVVGDDPWHDFCNVVLKIHLYTKEEVENGNDDNKSCLEQAAVLMEASKSSSVS
QPDSSPTVARV
Download sequence
Identical sequences V4N965
XP_006400848.1.70970 Thhalv10012728m|PACid:20205149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]