SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10014143m|PACid:20206480 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10014143m|PACid:20206480
Domain Number 1 Region: 14-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-18
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 213-309
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000765
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10014143m|PACid:20206480
Sequence length 316
Sequence
MTKNSCFGQIIEEGDNPGFFKVLRKEDLSTEIMRAIPHDFIRSISNKEFSFKMVLKLPWG
SSWPIKISRNERFYYMEKSGWDKFLSDNDLGHDELLTFTHKGHMCFSVNIYQIDCKEILR
PKKTATIASSSRNKREQGKNIYNDVKEEEIESLSESLSFPGSETDESTGRKLKQRRKINL
GKKKVEEAEKTKKKKKNVDTDCDHSEAGTSSLVPKFTLTIKKSYLKFLAVRKKFADMHMP
KETTMFKIHHSKEKRSWKVKYVVSDICESRFSPGWVRLAREFVLQVGDVCTFELIKPAEM
VLSVTKKRQCDVCEMI
Download sequence
Identical sequences V4N801
Thhalv10014143m|PACid:20206480 XP_006400353.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]