SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10014229m|PACid:20204077 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10014229m|PACid:20204077
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-19
Family B3 DNA binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  Thhalv10014229m|PACid:20204077
Domain Number - Region: 203-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000122
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10014229m|PACid:20204077
Sequence length 298
Sequence
MVFSPYPDFGFTFNSQDLSLSQRLVIPSDYRMYYPNPLPQTAVLRKPEGNFWNVKWTISQ
EGTISFEDGWSKFVTDNGPIHGDILLFSYDGCRNFFVRIYRNGLVVETKSPIKIQEISDD
DDERNSSDDDDDDHDMENEEDSNDENKIISLSLGSSDEDDDDDDDDDTTLAEVNKSNGSS
KKGGTSQKKRAESIGDPAMYLDDPTNPCFIPISSYRRMMVIAQQVIKDHDLKFGETINLI
DGFGQVEGKVVEWKDRIVVYSWDEVCKRNHAKLEDVIICEILHERGLVQSIKAHFVKK
Download sequence
Identical sequences V4LFY9
XP_006401176.1.70970 Thhalv10014229m|PACid:20204077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]