SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10014972m|PACid:20203483 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10014972m|PACid:20203483
Domain Number 1 Region: 9-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-23
Family B3 DNA binding domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10014972m|PACid:20203483
Sequence length 140
Sequence
MADNEVVLPRFFKFFLSVTTSESMSIPTTFTEHLKDPLPKTAKLQGTGGGTWTVNFSRIR
ERAYITAGWSKFAEEHELKDGEYLTFVYDGECTFEVSVYGRWGCKETRAVMQWSSFLILM
KKILQWPDASGESVFSEYFT
Download sequence
Identical sequences V4NBR2
Thhalv10014972m|PACid:20203483 XP_006401913.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]