SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10015099m|PACid:20204804 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10015099m|PACid:20204804
Domain Number 1 Region: 26-102
Classification Level Classification E-value
Superfamily TSP9-like 1.96e-24
Family TSP9-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10015099m|PACid:20204804
Sequence length 102
Sequence
MVSSLLMSFAPATVRCFATGAKGTSSNSTATKEEKSIIDFVLGSLTKQDQFYETNPLLKK
VDEKEGGTGGNGGRKTVSGGKNSVAVPQKKNGGGFGGLFAKK
Download sequence
Identical sequences V4LRM1
Thhalv10015099m|PACid:20204804 XP_006401030.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]