SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10016394m|PACid:20181239 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10016394m|PACid:20181239
Domain Number 1 Region: 151-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-42
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10016394m|PACid:20181239
Sequence length 616
Sequence
MGGLIDLNVMETEDETPSSASGSLSPSSSSSASASASAFAVSGSSSSSSSSGVCLELWHA
CAGPLISLPKRGSLVLYFPQGHLEQAPDFSAAIYGLPPHVFCRILDVKLHAETATDEVYA
QVSLLPESEDIERKVREGMIDVDGGEEDYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPR
RAAEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLV
SGDAVLFLRGDDGKLRLGVRRASQIEGASAFSTQYNQNMNHNNFAEVAHAISTNSVFSIY
YNPKASWSNFIIPASKFLKIVDYPFCIGMRFKARVESEDASERRSPGIITGISDLDPIRW
PGSKWRCLLVRWDDIEANGHQQRVSPWEIEPSGSISNSGSFVTTGPKRSRIGFSSGKPDI
PVSEGIRATDFEESLRFQRVLQGQEIFPGFINTSSDGGAGARRGRFKGTDFGDSYGFHKV
LQGQETVPAYSMTDHHRQQGLSQRNIWCGPFQNFSTRILPPTSVHVSSSPSSVLITNSSG
PNGHLEDHHGGSGRCRLFGFPLTDETTTVAPATVVPCVEGLNGHSMKGVSGVQSNHLHSQ
GRDMYGMRDMLLDIAL
Download sequence
Identical sequences V4MA80
XP_006410539.1.70970 Thhalv10016394m|PACid:20181239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]