SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10016632m|PACid:20179709 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10016632m|PACid:20179709
Domain Number 1 Region: 404-443
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000745
Family Rho termination factor, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10016632m|PACid:20179709
Sequence length 458
Sequence
MDDDDDLWGPPPVVQEEPPFKPLRGYEFWFDPRTDVLEEEYQNEKYCEQVRRILDGKKQD
TESNELDKVSDSLQKDMASSGAGDSPEIVSSDSDKTLSAISPDADTSSAKSALDEDENTS
SISDAQTKETKDSSNDTQVIDPETRKPQETSANDPITVEEGKVAEDADISSSPVFASKSE
EAEEHSPSSLVTDQVFDPIKQAPENRSLSELSRENIGGSTLKPLGLETTEKVREKANATN
EDGEMLKDQQQEIETSSEPFTTESRLEMCDASEKGRETPCDDRIKSSQSEAVKTAVKDEL
IVNSPTVARQKAESNALLKPGPDLTKKGQRKSKGMNTSFIRNTKPKVGGEAGEIDIDPVK
KSTQSTSKLSRGSSVPAQLSDSTSELIERIRQRDGQTMGDSVTSISELKNKTGKELRSIA
KELKMTHYSKLKKEDLLQQIINQLNLQPADCTEQKMES
Download sequence
Identical sequences V4LQJ3
Thhalv10016632m|PACid:20179709 XP_006411422.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]