SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10016746m|PACid:20179954 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Thhalv10016746m|PACid:20179954
Domain Number - Region: 365-397
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00169
Family Rho termination factor, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10016746m|PACid:20179954
Sequence length 403
Sequence
MALSGTLQLTSDYVPGYGVSDSRSFSNSAVSRRTLAILPCSSCLVHKLHIKNKHLKSAPN
KISFVCRASSSGHRRNNPDFSRNNKHGFRGGRNRRNEDRDGLDGGGGLEDSEMLSSKNGP
MFSLSNSPKFQATSSPGPREKEIVDLFRKVQAQLRARAAAKKEEKKTEEASKGQGGKESE
TVDSLLKLLRKHSGEQSKKKVSNFTSEKQLQEDDDAAERQDHSSNHFDSRNKDRNATPFT
RPASSFRRNSPVPRHKSPSSYSGEAMFDEASSYSVTWTQKKDQVESRDEPEYEPEYEPEE
SEPRLTLFGPEESEEPEESEPRLTLFESEPKLKPESFFLEEDELSDDDDDDDEPINAEEE
TAKDEDLSALKLIELRAIAKSRGLKGISKMKKADLVNLLANKA
Download sequence
Identical sequences V4NXQ2
Thhalv10016746m|PACid:20179954 XP_006410243.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]