SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10018331m|PACid:20192490 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10018331m|PACid:20192490
Domain Number 1 Region: 110-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.15e-29
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10018331m|PACid:20192490
Sequence length 582
Sequence
MSPPSANADVLREVDPRIWRACAGASVQIPTLYSRVYYFPQGHVEHCCASSVISSFPSST
SPVPCIVSSIELLADPITDEVFAHLFLQPIAPDQFMPPNFSRFGRYESEDEENKVVTFAK
ILTPSDANNGGGFSVPRYCADSVFPSLDFQADPPVQKLFITDIHGVLWDFRHIYRGTPRR
HLLTTGWSKFVNSKKLIAGDSVVFMRKSPDALFIGVRRAPISNSGGTSFYGGAGAGAGGD
EFSSYYQSSVVAAKDEDPSVKKGFRRTGRGKLTTEAVAEAINKAAQGLPFEVVYYPTAGW
SDFVVRAEDVEASMAIFWTPGTRVKMAMETEDSSRITWFQGIVSSTFQETGPWRGSPWKQ
LQITWDEPEILQNVKRVNPWQVEIVANSSQLHAAFPPTKRLKFPHSAGGLLSGEEGDHLY
SQRGLLSSVAPAGDPSPYMFPYTTFPAGMQGARHYEFGSFNPTGFIGENPPQLCNNNFFS
PLPGLGKVSTEMNFGSPPSEDLSPNSNTTNLSSGNDPVGNRGPTSARTNSFQLFGKIINV
QEPSESGLAESGLYEEDGSKESSDNEVLNETQLSLTHGPQGM
Download sequence
Identical sequences V4KJ90
XP_006390047.1.70970 Thhalv10018331m|PACid:20192490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]