SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10019801m|PACid:20191643 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10019801m|PACid:20191643
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000667
Family B3 DNA binding domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10019801m|PACid:20191643
Sequence length 73
Sequence
MVIKKTLCDTDVSQQGRLNLPRQDFEDLIIPDIAKDLVQNLGNGVKVKVFVVDEEEYIVT
LKKKSNGSYILSA
Download sequence
Identical sequences V4KN60
XP_006391462.1.70970 Thhalv10019801m|PACid:20191643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]