SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10021075m|PACid:20182250 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10021075m|PACid:20182250
Domain Number 1 Region: 237-338
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-22
Family B3 DNA binding domain 0.0057
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.35e-21
Family B3 DNA binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10021075m|PACid:20182250
Sequence length 341
Sequence
MPRPFFHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKAENKIW
FQDGWQEFVDRYSIRIGYLLIFRYEGNSAFSVYIFNLSHSEINYHSTGLMDSAHNHFKRA
RLFEDLEDEDAEVIYPSSVYPSPLPDSTVPANKGYSGSAIQSLFTGPVKAEEATPTPKVP
KKRGRKKKNADPEEINSSAPRDDDPENRSKFYESASARKRTVTAEERERAINAAKTFEPT
NPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKVQLAEKQWPVRCLYKAGRAKFS
QGWYEFTLENNLGEGDVCVFELLRTRDFVLKVTAFRVNEYV
Download sequence
Identical sequences E4MXM2 V4M6R9
Thhalv10021075m|PACid:20182250 XP_006406545.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]