SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10021305m|PACid:20183091 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10021305m|PACid:20183091
Domain Number 1 Region: 31-145
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.27e-30
Family B3 DNA binding domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10021305m|PACid:20183091
Sequence length 276
Sequence
MSVNYYSRDIIHHNTLSLHHHQNDAVAQRESLFEKSLTPSDVGKLNRLVIPKQHAEKYFP
LNNGGGGDDVAAETTEKGMLLSFEDESGKCWKFRYSYWNSSQSYVLTKGWSRYVKDKHLD
AGDVVFFQRHRFDLHRLFIGWRRRGEASSSSAVSAVSQEARVNTTAYWSGLTTPYHQVHA
STTYPNIHHEYSHYGAVAESPTVVAGSSRTVRLFGVNLECHGDVVEPPPCPDGYNGQHIY
YYSTPNPMVVFRWSYCGVKFRSIAKLRLSNQSNGAN
Download sequence
Identical sequences V4LEI4
XP_006407432.1.70970 Thhalv10021305m|PACid:20183091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]