SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10022244m|PACid:20182095 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10022244m|PACid:20182095
Domain Number 1 Region: 65-172
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000022
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10022244m|PACid:20182095
Sequence length 184
Sequence
MVYTENSRPSSSTTPRTLDLFPTQPGDLARVVSSADDRVVSLAHLRNNLTEAAARNILTL
STIPRWVIKKTLTRSDVAKSQTRLLIPMQSVNEHIRKYLMNDKIGMIEDEDSKGWIVNVY
DTDTHSTHTLCLKKWNSTGSYVLKKNWRKDFVIRRNLQEGHEIGILWNPTEERLNFCVFP
PPDH
Download sequence
Identical sequences V4LG99
Thhalv10022244m|PACid:20182095 XP_006408057.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]