SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10022269m|PACid:20183256 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10022269m|PACid:20183256
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000745
Family B3 DNA binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10022269m|PACid:20183256
Sequence length 96
Sequence
MIRVLLIEKTLDENDVDPSQNRLLIPFKILKRHDFLTSDEMKILGDDSINNEGRMGVGAF
LVDQRTSQWNVVLKKCVLKYLKNLILKYYTFYFAET
Download sequence
Identical sequences V4NSM2
Thhalv10022269m|PACid:20183256 XP_006408218.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]