SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10022780m|PACid:20202142 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10022780m|PACid:20202142
Domain Number 1 Region: 218-316
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000122
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 15-47,80-136
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000128
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10022780m|PACid:20202142
Sequence length 323
Sequence
MATNPDFLMCKEERKNESFFKVLQGADIYSENMNVSGKFESFWFIVKMGLRKLNLSVQRV
LKKEQFLMIFMRSVSEHELSGKMKIRAEWGSSWDIGISKNPRFYFMEKSGWEKFVRENYL
EEDNFLTFTHKGNMGFNKDGLEIISPPQSMAFFASSSQVKREGGEVVSPDLGPTATETNR
EGKFKRKVNSGKKKIKESESSPLIKEAFSARRDCAGASSSSSAEFTVFIKGSHLKILKIS
VSASRNLLPKERTTFKIHHPDMKKSWNVVYIPRHEQGLSGYFSSGWRILVQEYPVLVGEA
CKFTFLKPTELLLIVSKRAKETH
Download sequence
Identical sequences V4LKG0
XP_006409537.1.70970 Thhalv10022780m|PACid:20202142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]