SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10023054m|PACid:20202135 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10023054m|PACid:20202135
Domain Number 1 Region: 3-84
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-16
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 169-247
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000011
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10023054m|PACid:20202135
Sequence length 250
Sequence
SQRAIPYDFMRSVSEHELSGKMKIRAQWGSSWDIGISKNPRFYFMEKSGWEKFVRENYLG
EDDFLTFTHKGKMCFNVKIFKKDGLEMICPQQSMAFFASSSQVKREGDEVVSPDLGPTAT
ETNGEGKFKRKLNSGKKKAKESESSTMIKETVSARRDCAGASSSSSAEFTPIRVSVSRNL
MPKQRTTFKIHHPDMKKSWNVVYVPRHEAGGLFSSGWRILVQEYPVLVGEACKFTFLKPT
ELLLIVSKRA
Download sequence
Identical sequences V4MEH2
Thhalv10023054m|PACid:20202135 XP_006409470.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]