SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10024526m|PACid:20195208 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10024526m|PACid:20195208
Domain Number 1 Region: 329-430
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-19
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10024526m|PACid:20195208
Sequence length 728
Sequence
MSSSSSLSSRFCFNRECSEFKLEHYRPGWRLQTGDFADLCHRCASAYEQGKFCDIFHQRA
SGWRCCESCGKRIHCGCIVSASAFMLLDVGGIECLACARKKVALGPNYLPQLPIFFQSPI
AEKFKDLSINWNSSTGSNQISCRPPSFLGQSVLQFDLHNRGDSYEFSRPTSKDRATACSI
EKKWGMNDLMGKLMSEKSKSHTSDILNNQNAGPNCEVLPSSNVNVYRPLISLKEGPCGTQ
LAYPVPLTTPIETNVHSRLNGRSLWHTPKSSSLNFLRNDLNGGADSLCSLTHLDTPGKYQ
VVPRYWPKVSYKNQVPQNLSKESESVVIPLFEKMLSASDTGRVGRLVLPKKYAEAFLPRL
SNTEGVPLKVQDSMGKVWTFQFRFWPSNNSRIYVLEGVTPCIQSMQLQAGDTVIFSRVDP
ERKLIMGFRKASVAQSADQETDSTNNNRDSCTNGDGESIDNHSPSRAKKSAYKAKETPGV
GFSSRKKKSSMMITRSKRQKVEKGDHTELKLTWEEAQGFILPPPSLTPSIIKIEGFEFEE
YKDAPIIGKPTTGSTCSANKKLLAEQYDEEAMEETEGLMMSPKETTKHPRHRRGCTCIVC
IQSPSGTSPKHDNCCSCTVCDAVKRRRRSLLLGRKNKQIEKENKAQKELESLNSDEELHQ
SANNSGTTSKSHEHDASPQKGQIDLNFQPEKEEESLHKTTKDKSLHHDDTSFKPSSSSSA
HSQIEKQD
Download sequence
Identical sequences V4MIN2
Thhalv10024526m|PACid:20195208 XP_006413764.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]