SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10024662m|PACid:20195558 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10024662m|PACid:20195558
Domain Number 1 Region: 110-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-38
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 521-602
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000128
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10024662m|PACid:20195558
Sequence length 637
Sequence
MANRGGDGGGEHLYDELWKLCAGPLVNVPQAEERVYYFPQGHMEQLEASTQQDLNTMKPL
FNLPPKILCRVMNVRLQAEKDTDEVYAQITLIPEGTQVDEPMSPDPSPPETQRPKVHSFS
KVLTASDTSTHGGFSVLRKHATECLPPLDMTQQTPTQELVAEDVHGYQWKFKHIFRGQPR
RHLLTTGWSTFVTSKRLVAGDTFVFLRGENGELRVGVRRANRQQSSMPSSVISSHSMHLG
VLATACHATQTRTMFTVYYKPRTSQFIISLNKYLEAMTNKFSVGMRFKMRFEGEDSPERS
FSGTVVGGKDCSPHWKDSKWRCLEVHWDEPASISRPDKVSPWEIEPFVTSENVPQSVVLK
NKRPRQVSEVSALDVGITASNLWSSALTQSHEFAQSCITSQRNSPKQYYRDAIEDAKNPD
WPISPYSVSNVSKDSTLNDQMVFPVKQKKPETTASYRLFGIDLMSSSIAASEEKTAAMRP
INITKPTPESNSDPKSEISKVSEEKKQEPAQASPKEVQSKQSSSTRSRTKVQMQGVPVGR
AVDLTVLSGYSELIDDLEKLFDIKDELRSRSQWEIVFTDDEGDMMLVGDDPWPEFCNMVK
RIFIWSKEEVKKMTPGNQLRMLLTEVETASKTDNHSD
Download sequence
Identical sequences V4P5Z3
Thhalv10024662m|PACid:20195558 XP_006413488.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]