SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10024698m|PACid:20195209 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10024698m|PACid:20195209
Domain Number 1 Region: 216-313
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.11e-17
Family B3 DNA binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10024698m|PACid:20195209
Sequence length 611
Sequence
MLLDVGGIECLACARKKVALGPNYLPQLPIFFQSPIAEKFKDLSINWNSSTGSNQISCRP
PSFLGQSVLQFDLHNRGDSYEFSRPTSKDRATACSIEKKWGMNDLMGKLMSEKSKSHTSD
ILNNQNAGPNCEVLPSSNVNVYRPLISLKEGPCGTQLAYPVPLTTPIETNVHSRLNGRSL
WHTPKSSSLNFLRNDLNGGADSLCSLTHLDTPGKYQMLSASDTGRVGRLVLPKKYAEAFL
PRLSNTEGVPLKVQDSMGKVWTFQFRFWPSNNSRIYVLEGVTPCIQSMQLQAGDTVIFSR
VDPERKLIMGFRKASVAQSADQETDSTNNNRDSCTNGDGESIDNHSPSRAKKSAYKAKET
PGVGFSSRKKKSSMMITRSKRQKVEKGDHTELKLTWEEAQGFILPPPSLTPSIIKIEGFE
FEEYKDAPIIGKPTTGSTCSANKKLLAEQYDEEAMEETEGLMMSPKETTKHPRHRRGCTC
IVCIQSPSGTSPKHDNCCSCTVCDAVKRRRRSLLLGRKNKQIEKENKAQKELESLNSDEE
LHQSANNSGTTSKSHEHDASPQKGQIDLNFQPEKEEESLHKTTKDKSLHHDDTSFKPSSS
SSAHSQIEKQD
Download sequence
Identical sequences V4P6M6
XP_006413763.1.70970 Thhalv10024698m|PACid:20195209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]