SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10024893m|PACid:20192994 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10024893m|PACid:20192994
Domain Number 1 Region: 153-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-18
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 294-392
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-17
Family B3 DNA binding domain 0.016
Further Details:      
 
Domain Number 3 Region: 27-88
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000549
Family B3 DNA binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10024893m|PACid:20192994
Sequence length 530
Sequence
MADPPNISLFHQRFLTGDNPLLTLDDEFLRHYTKVLLRSDASDRIWEVKLNGNRLAGGWE
EFAAVHRFRDGDVLVFRHDKDENFHVSVGSRSDSCDMQHASPSIVDTDDTEIDDDYVESA
DHHDDGEDEDEDDAGDIVVSKNKKPEAESSSGDPCFITAHVTPYSLIKDRLDLSRNFTVA
SFDEDNKPCEIDLANEKGRKWTLLLRRNISTGVFYIRRGWTNFCSSNELRQGDLCKFKLS
ENGERPVLWLCPQEYGNGHEEQECPRVSAEGGCSKEKSMLDEIPKGKEKNTPSTFLKIKL
TPNRFKSGQLYISSVFVNESGINNAGEITLLNKDGRKWSSYLHMTGKCGTEWFYLRKGWK
EMCKANGVKVNDSFVLELIWEDANPTFKFYSKEENHENKGKGNRRTRKRRACGTDLQGSS
EEKSRRVEREGRRVSRRAEHDEKEKRGNTQVSNRPTTNSSKLQRKQAKPCSVSDQVANVK
RGILDTLKTVSQFRAELETREKKLEAALLEIEALGERILGISQILNNNLV
Download sequence
Identical sequences V4P3P1
XP_006412578.1.70970 Thhalv10024893m|PACid:20192994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]