SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10025105m|PACid:20195192 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10025105m|PACid:20195192
Domain Number 1 Region: 9-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-22
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 119-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-20
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 3 Region: 223-294
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-16
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 4 Region: 364-465
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000314
Family B3 DNA binding domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10025105m|PACid:20195192
Sequence length 470
Sequence
MANASLFSPANPHFFQPLLSRFQSHLKIPVKFFSKHIEGKHEGKTVTLTSDSSKRTWKVK
MEGHRLTDGWKEFVKAHDLRIGDFVVFRHEGDMLFHVTALGTGESSRKENDLKRESDQSS
SDLTCFSQIVTASNLSRAVVGVPIDFARRNGLDKGRQKIVLMNKKGMSWKSEVKTSTAGQ
VFICRNWRSFCTANKLEVGDSFKFQLLQNTETPVFQLCSLAEFLPRKFVRPDGLNKSSKK
ISLINEDARIWTLILKFRESTRTFYMRSGWRSFCRENGLKPGDSATFKLESNSTGRPLLS
FSSSESKCVSKKHINKWKRIETGESSQRVSPPSSSSSSSSSSSSSSSSSSSSSSSSSSSS
CSQSESRFVTLNVTPGTFKHCRIYLPKSFTRNNGMENAQGKNVTLLDNHRVEWPVNLVML
KGSRRMHLGSGLIEFLRAIGVEAYKSFVLELVWEDKTSPPVLKFCSKVNI
Download sequence
Identical sequences V4P3N9
XP_006412573.1.70970 Thhalv10025105m|PACid:20195192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]