SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10026054m|PACid:20194502 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10026054m|PACid:20194502
Domain Number 1 Region: 4-49
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000216
Family B3 DNA binding domain 0.0012
Further Details:      
 
Domain Number 2 Region: 155-250
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000175
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10026054m|PACid:20194502
Sequence length 254
Sequence
MKRKQDEVYFEQGWVKFVEDNSLSDGDFLTFVYNGDRIFEVSIYGPDGCKEVRAVTEADD
DEEDSSNDTDAISESEVVTTIPRSKNKGKSKVGVVEESDDDEEDSIYTDTETETDTGFPG
KSKLTEDVDDSVKLQRERVKPKIKNPEAYLDNPRNIYFETGVKKRIYELLIHAQLVKDYS
LKFEKNIYYIDNHKNGKLEAKTTMWKDQRVYIKKWQRICKRNSLKKEDGILCELFRRQGL
VYAVKVHIIREKDL
Download sequence
Identical sequences V4MBB8
XP_006412226.1.70970 Thhalv10026054m|PACid:20194502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]