SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10026132m|PACid:20193960 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Thhalv10026132m|PACid:20193960
Domain Number - Region: 199-229
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000589
Family Rho termination factor, N-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10026132m|PACid:20193960
Sequence length 235
Sequence
MDLALHFPCVYPMIKQGFRRATHLPLRDSPSPSFGQSLSRTVFNGDRRSWPQEDASSSSS
GRSKKGSVCCKKRSDERSSSPSKSKQEEIISLFRRIQSSISKGDSQGAEEKNRNGSSERE
PLSKAILDVLEKPRKKPEGDTGVKSEPPKRQGNVARPPSSVAKRSPVGPSTSGPRGKLPI
SKSDKALEETAKEEKPPLIETMKLAELKEVAKKRGIKGYSKLKKSEILELLRSHF
Download sequence
Identical sequences V4MJF0
XP_006414064.1.70970 Thhalv10026132m|PACid:20193960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]