SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10026276m|PACid:20194236 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10026276m|PACid:20194236
Domain Number 1 Region: 41-99
Classification Level Classification E-value
Superfamily DNA-binding domain 3.66e-21
Family GCC-box binding domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10026276m|PACid:20194236
Sequence length 202
Sequence
MQDSSSPPLGSQRNLRSPAPERTGKNSKSKNEQKGVSKHPNFRGVRMRQWGKWVSEIREP
RKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPASADPKDIQAAAA
AAAVEWKAPESPSSTATSSMTSSPLADDAFSDLPDLLLDVNDHHKIDGFWDSFPCEEPFF
LENYKEIGIWKEANSGRRTISR
Download sequence
Identical sequences V4LYJ8
Thhalv10026276m|PACid:20194236 XP_006414307.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]