SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10027046m|PACid:20194382 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10027046m|PACid:20194382
Domain Number 1 Region: 10-101
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000153
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 184-274
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000235
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 3 Region: 299-396
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.011
Further Details:      
 
Weak hits

Sequence:  Thhalv10027046m|PACid:20194382
Domain Number - Region: 115-156
Classification Level Classification E-value
Superfamily ARM repeat 0.00633
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10027046m|PACid:20194382
Sequence length 501
Sequence
MADPSIPPKHNPSFFLASLADQNSIPRIPDAFFHAHLEHKKELVKLKLTSDAFERTWEVK
LNGRSFAGGWEDFSAAHCLKDDDVLIFRHHGDMTFHVTPSGRSFSKILCISSSSDDSDDD
DDDDDSEDDDDDSDNDSEDDDDEDDDDDETWDNGSDSKNILSKEKSRLKAESSSSENSCF
LAPTPSNLRQDRVSLTKRFSRTNALNKRWCVIDLMNQRGKSWALGLRHNKVTGQDYILGG
WRSFCRANELKTGIFYRFELVRNGARPLLQLCSDITSQGNCSKANRKAKVSAKSSREDES
ASLTVTLKPYMLKSRQLRLSSDFSRKNGIKKEGEITLVDKNGVKWPSYVVCVQGRLYITK
GVIDFWAANQIETGETFTLELVRGEGTTPMLKFCSKAKVQEETETRFQKRARVSSEGGPS
RCTQASNKSTAAPKNLECKQPLQPCSFSDQLTKVKQCSVGIITDVRRFRSELEIKEQNLE
ALLQELSALGEKVLEINKIIK
Download sequence
Identical sequences V4MMK7
Thhalv10027046m|PACid:20194382 XP_006412575.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]