SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10027164m|PACid:20194005 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10027164m|PACid:20194005
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-25
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 145-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-21
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 3 Region: 249-333
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000294
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10027164m|PACid:20194005
Sequence length 437
Sequence
MENASLFSPANPHFFQPLLTGSHSHLSIPVKFFSKHIEGKYEGKTVTLRSDASEKTWKVK
MEGQRLTEGWKEFVRAHDLRIGDFVVFRHEGDMLFHVTALGPSCCEIQYAPSGSRDEDKE
ETSETGSETSDKEVEPNLSGTSNHSSSDLTCFRQFVTASNLSRDTVGVPSAFAKRNGLNK
GSQEIILMNEEGRSWPSQQKTLVDYRIVIVRGWTSFCTANKLEAGDSCTFKLLQNANTPV
FRLCSRTKHLPVSFTRANGLIKPEKVILVDKNRAEWSMNLKVEKGSGTMYIMSGKHWKRF
CAVNEVGAGESLTLELIRGGKLHNNYLCFQMEQSPFDAQARTHKRARVQRWISQETRPKH
EIREKAAEEGEPFRRTRASNNANQGNLENTHPCSVSDLVPKVKQSVADTLTSIRLFREEL
EKMEQKLEDSLQEIDNL
Download sequence
Identical sequences V4MMK3
XP_006412570.1.70970 Thhalv10027164m|PACid:20194005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]