SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10027563m|PACid:20194119 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10027563m|PACid:20194119
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-17
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 125-204
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-17
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 3 Region: 219-314
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10027563m|PACid:20194119
Sequence length 322
Sequence
LFFQASTTTSYLTSLNIPLKFFSKHIQGRNERNTAEVRSDACKNTWKVKMEGRRLTDGWK
EFTIAHDLRIGDIVIFRHEGDLVFHVTCFGPSCTEIQYDVQPQDNIGNLSEKQNLKTERE
SFSSDQSCFVARFLPRKFVRPDGLKKSSNKISLINEGARTWTLILKFRESSRTFYMRSGW
RSFCGENGLKPGDSVTFKLEGNSTGRPRLSFSSSESNESRFVTLSVTPASIKHRRLYLPK
SFTRNNGMENAEGKVLLLDKHGVEWPVNLVLSKRDRRMRLGSGLKEFLKAIDVTAYKSFV
LELVWEDTTTPPMLKFCSKVKT
Download sequence
Identical sequences V4LTV4
XP_006412572.1.70970 Thhalv10027563m|PACid:20194119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]