SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10027627m|PACid:20189583 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10027627m|PACid:20189583
Domain Number 1 Region: 393-561
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.14e-50
Family BRCA2 helical domain 0.00042
Further Details:      
 
Domain Number 2 Region: 562-690
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.86e-37
Family Single strand DNA-binding domain, SSB 0.00018
Further Details:      
 
Domain Number 3 Region: 692-721,839-924
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-24
Family Single strand DNA-binding domain, SSB 0.0089
Further Details:      
 
Domain Number 4 Region: 722-839
Classification Level Classification E-value
Superfamily BRCA2 tower domain 3.14e-18
Family BRCA2 tower domain 0.0038
Further Details:      
 
Domain Number 5 Region: 930-1064
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000261
Family Myf domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10027627m|PACid:20189583
Sequence length 1075
Sequence
MSTWQLLSDPGGDNFRWEVGGRIRQSDNSDSTTSTKTIDSTAPPLPSMADLLLRGCSKLI
EREEAMPTMFTTGLGKSVSLKDSSISRAKSILADSDNNVLPRESGFGVPNTLFQTASNKK
VNVSSAGLAKARALLGLQEDDLNGFNHANCSSSSQEKHEWSGLKSHDATSVQHPSVTPGR
QYESHVSGRRSDMLTPASKVPQTKFQTAGGRSLSVSVEALKRARSLLGDPELGNFFDDVA
ADDQFVTPQKDERSGDIANTGYTAHKGTTSNKHTSNSFISPLQTSSKQFRSVRLENISSG
GNLIKKFDAAVDETDCALNITKPATHGLSNDRPLASDMAVNNPTKKGFIPRAKQFGRPAD
QPLVDITNRSERTYANNKQDSSQKKRLGKTVSVPPFKKPRTSSFKPPLMNNAQHASNGLS
VKLCDTHYSKKVLSTRFKERSPRVYIKDYFGMHPTATSKMVYVPDHVRRIKSSNADRYVF
CDEPSSSVVGAETFHQILAECGASLQHASRKWVTNHYRWIVWKLACYETYYPAKCRRNFL
TIPNVLEELKYRYDREANHGHCSAIKRILSGDAPASSMMVLCISAINPKTDDDYQETHGS
YSGSNVKIELTDGWYSMNAALDVMLTKQLNAGKLFIGQKLRILGAGLSGWATPTSPLEAR
TSNTIFLLLNINGTYRAHWADRLGFCKEVSVPLSLNCIKSNGGPVPKTIAGITRIYPILY
KERLGERKAIVRSERMESRMIELHNQRRSALVEGLICEYERGINGVHSQNDTDSEGAKLY
TLLETAAEPELLMADMSMEQLTSFAAYKSKFEAARQKKMEKSVTEALEDAGLGERDVTPF
MRVRLVGLTSLSSEGKHNPKEGIVTIWDPTDTQITELTEGKIYIMKGLAPINSDSQTLYL
HARGSTSGWQPLSPKASESFQPFFNPRKPISLPNLGEIPLSSEFDIAAYVVYVGNVYTDV
EQKKQWVFVTDGSFQRLHSGEISYSLFAISFSTPSMDDFPITLFSQNLVGSVVGFCNLLK
RAKDTKNDMWVGEATENSDYSVNAEDAYSSHLKTSCASIEKWAKLSASNSVRSLQ
Download sequence
Identical sequences V4LU44
Thhalv10027627m|PACid:20189583 XP_006405906.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]