SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10028392m|PACid:20197881 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10028392m|PACid:20197881
Domain Number 1 Region: 93-286,407-454
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-65
Family Tandem AAA-ATPase domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 750-970
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 2.35e-60
Family Helical scaffold and wing domains of SecA 0.000041
Further Details:      
 
Domain Number 3 Region: 455-564,661-744
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-49
Family Tandem AAA-ATPase domain 0.0000133
Further Details:      
 
Domain Number 4 Region: 285-407
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 7.59e-44
Family Pre-protein crosslinking domain of SecA 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10028392m|PACid:20197881
Sequence length 1006
Sequence
MMVSPLCDFQLLNLRPSISPTASHFVIAEGKFLRQNRLLSSSPFLGAKFGNGFKSGLPGC
SSCSRRRSTSVNASLGGLLSGIFKGTDNGESTRQQYASIVASVNRLETEISSLSDSELRE
RTDALKQRAQRGESMDSLLPEAFAVVREASRRVLGLRPFDVQLIGGMVLHKGEIAEMRTG
EGKTLVAILPAYLNALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQNMTPEQ
RKENYLCDITYSVEELVLRDFNYCVIDEVDSILIDEARTPLIISGPAEKPSDQYYKAAKI
ASAFERDIHYTVDEKQKTVLLTEQGYEDAEEILDVKDLYDPREQWASYVLNAIKAKELFL
RDVNYIIRAKEVLIVDEFTGRVMQGRRWSDGLHQAVEAKEGLPIQNESITLASISYQNFF
LQFPKLCGMTGTASTESAEFESIYKLKVTIVPTNKPMIRKDESDVVFKAVNGKWRAVVVE
ISRMHKTGRAVLVGTTSVEQSDELSQLLREAGIPHEVLNAKPENVEREAEIVAQSGRLGA
VTIATNMAGRGTDIILGGNAEFMARLKLREILMPRVVKPTDGVFVSVKKAPPKRTWKVNE
KLFPCKLSSEKVKLAEEAVQSAVEAWGQKSLTELEAEERLSYSCEKGPVQDEVIGKLRNA
FLEIAKEYKGYTDEERKKVVEAGGLHVVGTERHESRRIDNQLRGRSGRQGDPGSSRFFLS
LEDNIFRIFGGDRIQGMMRAFRVEDLPIESKMLTKALDEAQRKVENYFFDIRKQLFEFDE
VLNSQRDRVYTERRRALVSDSLEPLIIEYAELTMDDILEANIGPDTPKESWDLEKLIAKV
QQYCYLLNDLTPDLLKSQGSSYEGLQDYLRARGRDAYLQKREIVEKQAPGLMKDAERFLI
LSNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIEYKLEGYNLFLEMMAQIRRNVIYSIY
QFQPVMVKKDQEKKSQNGKPSKQVDNVSEKPNQVGVADEPSSIASA
Download sequence
Identical sequences V4L2E5
Thhalv10028392m|PACid:20197881 XP_006396371.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]