SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10029379m|PACid:20196948 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10029379m|PACid:20196948
Domain Number 1 Region: 124-252
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-32
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 509-587
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000719
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10029379m|PACid:20196948
Sequence length 721
Sequence
MENNQVMDAEYEFPGIDNSRLDYLYDELWKLSAGPLFDLPKFGEKVYYFPQGHIEHLEAH
TKDELSQLRPIFDIPSRIGCSVIDIQLKVENETDEVFAKIALLPDTAEVEIPISNVNHER
IKVSSFIKVLTASDTSTHGGLSVIKRHAVECLPPLDMSQPTPSQEIVAKDLHGCEWKFKH
IFRGSPLRHIFTTGWSGFATSKRLVTGDSFIFLRGENGESRVGIRRAVHQQRSIPLSIIS
KESMHHGITATAMNAINTKSMFIVFCKLRSSQFIVNFDKVVDAVNNKFYVGSRFTMRFEN
YDFTVIRYSGTIIGKKDFSSHWRDSEWRCLEVQWDEPALIPRPNKVSSWEIEHMGSSSNV
HQSALLKNKRSRQAKETSSNLWPPTLTQGQEIGQSTVNFPMSVPPLSYCDATDSSNISSG
WPIGYSVPTMPKPNYNNEMVMSVKEKMTTAVTTANYRLFGVDLTSPRETEDPIRQIDSYQ
KSEMCKITKEKNCDQIQTRASPKEIQSKSTRSRIKVHMQGVAIGRAVDLTILDGYNQLID
ELEKLFDLKDELHTRNQWEIIFTDDEGDMMLVGDDPWPKFCNMVKKIFICSKEEVGSQMT
CADGIIQVGGSVEGCEGSPVQPQSEAQQIRTEPSSSGGAHQTSPNRAQAAFDPTALMNAF
AAQMQELVRSNDAKFATLTAQISNLQQESPIRRRNLISDFQEERDPQCTVARSVVQQYQQ
T
Download sequence
Identical sequences V4KKN9
Thhalv10029379m|PACid:20196948 XP_006396992.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]